McDonnell Genome Institute

Washington University

Transcript

lnc-PTPRU-11:1

Chromosome

chr1

Gene Name

lnc-PTPRU-11

Start

30253345

CPC Label

noncoding

End

30261161

Cancer

PRAD

Strand

+

Peptide

SQDDANWTSR

Modified Peptide

‚Äč

Peptide Length

10

ORF Length

84

Open Reading Frame (ORF)

LKQTRLADPAMKSACLVGLQTRRPPPIGRSQDDANWTSRCLTTQESLWSKTCRPAPSCTPPTCFLYHVSLLKPSHSAQKVGLVF

Conservation Score

0.951

PhyloCSF Frame 1

0

No. of Spectra

15

CPC Coding Probability

0.342068

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9339

PhyloCSF Frame 3

0

CNTI Score

-0.360649054