McDonnell Genome Institute

Washington University

Transcript

lnc-PTPRK-1:1

Chromosome

chr6

Gene Name

lnc-PTPRK-1

Start

128580112

CPC Label

noncoding

End

128580884

Cancer

OV

Strand

-

Peptide

KMQIQCVVEDDKVGTDLLEEEITK

Modified Peptide

n[145]KMQIQCVVEDDKVGTDLLEEEITK

Peptide Length

24

ORF Length

107

Open Reading Frame (ORF)

LREERLRLYAKKAKNPSLVAKSSILLDIKPWDNKTDMTQLEACVRSIQLDGLVSGASKLASVGYGIRKMQIQCVVEDDKVGTDLLEEEITKFEEHVQSVDIAALNKI

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.432148

PhyloCSF Frame 2 

0

CNTI Index

coding

Max Probability

0.6725

PhyloCSF Frame 3

0

CNTI Score

0.772014747