McDonnell Genome Institute

Washington University

Transcript

lnc-PTPRJ-3:1

Chromosome

chr11

Gene Name

lnc-PTPRJ-3

Start

47796168

CPC Label

noncoding

End

47796379

Cancer

EOGC

Strand

+

Peptide

INQKAVDSQILPK

Modified Peptide

n[145]INQKAVDSQILPK

Peptide Length

13

ORF Length

44

Open Reading Frame (ORF)

LRKPRHQEGEIFHTEKEKYEITEHSRINQKAVDSQILPKIKAIP

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

39

CPC Coding Probability

0.0121163

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9649

PhyloCSF Frame 3

0

CNTI Score

-0.354372883