McDonnell Genome Institute

Washington University

Transcript

lnc-PTPRC-10:1

Chromosome

chr1

Gene Name

lnc-PTPRC-10

Start

199290571

CPC Label

noncoding

End

199295414

Cancer

LUAD

Strand

+

Peptide

AIIYLQLLLGL

Modified Peptide

n[230]AIIYLQLLLGL

Peptide Length

11

ORF Length

42

Open Reading Frame (ORF)

LLRVRQILWKAREHKKPSVRFVEALRPRLLRAIIYLQLLLGL

Conservation Score

0.273

PhyloCSF Frame 1

-5.784

No. of Spectra

2

CPC Coding Probability

0.131999

PhyloCSF Frame 2 

-5.204

CNTI Index

noncoding

Max Probability

0.9946

PhyloCSF Frame 3

-3.486

CNTI Score

-0.411485261