McDonnell Genome Institute

Washington University

Transcript

lnc-PTPRB-4:1

Chromosome

chr12

Gene Name

lnc-PTPRB-4

Start

70446459

CPC Label

noncoding

End

70447585

Cancer

PRAD

Strand

-

Peptide

KTTSPVWVEQWPIK

Modified Peptide

‚Äč

Peptide Length

14

ORF Length

178

Open Reading Frame (ORF)

LKIIKIKRKTTSPVWVEQWPIKKEKLEHIQRLVQEQHAGHIEPPASPWNTPIFTIPKRSGKWGLLHDLCAINAVMLPMGPLQPRLPSPGMIPKDWLLIIINLRNCFFTIPLHPEDREKFTFTIPTYNNQQPVQRYQWRVLPQEMINSPLHVSFTYLKPYFLCVHPSPRQKSSTMWMIF

Conservation Score

0.735

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.48105

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9162

PhyloCSF Frame 3

0

CNTI Score

-0.377196861