McDonnell Genome Institute

Washington University

Transcript

lnc-PTPN23-6:1

Chromosome

chr3

Gene Name

lnc-PTPN23-6

Start

47499840

CPC Label

noncoding

End

47500407

Cancer

BRCA-Luminal B

Strand

+

Peptide

LLLQTHWRVNMWLAGGSRTSMLLSR

Modified Peptide

n[145]LLLQTHWRVNM[147]WLAGGSRTSMLLSR

Peptide Length

25

ORF Length

114

Open Reading Frame (ORF)

LQWDPEAKHMEVEDVTLNRRACSFRVLVVSAKFEGKLLLQTHWRVNMWLAGGSRTSMLLSRKPSSQSSGLVNGRKEGLASAQPLNYKSGPEKREKNEADPCVIFGQWTTKYTVY

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.238398

PhyloCSF Frame 2 

0

CNTI Index

coding

Max Probability

0.8026

PhyloCSF Frame 3

0

CNTI Score

0.657256001