McDonnell Genome Institute

Washington University

Transcript

lnc-PTPN20-2:1

Chromosome

chr10

Gene Name

lnc-PTPN20-2

Start

47032294

CPC Label

noncoding

End

47035557

Cancer

OV

Strand

+

Peptide

LGHYLGMSMK

Modified Peptide

n[145]LGHYLGM[147]SMK

Peptide Length

10

ORF Length

52

Open Reading Frame (ORF)

LGHYLGMSMKKGGRSFRPGRECIKSGGGRDPPGRWRIFTMTRAAKGNRSSGR

Conservation Score

0.031

PhyloCSF Frame 1

-5.236

No. of Spectra

1

CPC Coding Probability

0.0525276

PhyloCSF Frame 2 

-5.564

CNTI Index

noncoding

Max Probability

0.205

PhyloCSF Frame 3

-3.728

CNTI Score

-0.343214633