McDonnell Genome Institute

Washington University

Transcript

lnc-PTPN2-7:1

Chromosome

chr18

Gene Name

lnc-PTPN2-7

Start

13139779

CPC Label

noncoding

End

13140489

Cancer

EOGC

Strand

-

Peptide

GEADLLFTNHWK

Modified Peptide

n[145]GEADLLFTNHWK

Peptide Length

12

ORF Length

73

Open Reading Frame (ORF)

LKDIRNAWKHSRMFFGKNKVMMVALGRSPLGECKDNLHQVSKRLRGEADLLFTNHWKEEVNEWFTEYTEMDFS

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

8

CPC Coding Probability

0.269728

PhyloCSF Frame 2 

0

CNTI Index

coding

Max Probability

0.9022

PhyloCSF Frame 3

0

CNTI Score

0.683381767