McDonnell Genome Institute

Washington University

Transcript

lnc-PTPN2-4:1

Chromosome

chr18

Gene Name

lnc-PTPN2-4

Start

12785477

CPC Label

noncoding

End

12787741

Cancer

OV

Strand

-

Peptide

LQSLGGDIK

Modified Peptide

n[145]LQSLGGDIK

Peptide Length

9

ORF Length

35

Open Reading Frame (ORF)

LQSLGGDIKNSTALTIVIPSICCLFEFSFIFTLWH

Conservation Score

0.959

PhyloCSF Frame 1

-5.598

No. of Spectra

3

CPC Coding Probability

0.0248832

PhyloCSF Frame 2 

-5.838

CNTI Index

noncoding

Max Probability

0.9846

PhyloCSF Frame 3

-5.318

CNTI Score

-0.442709635