McDonnell Genome Institute

Washington University

Transcript

lnc-PTPN2-12:1

Chromosome

chr18

Gene Name

lnc-PTPN2-12

Start

12946700

CPC Label

noncoding

End

12947705

Cancer

CCRC

Strand

-

Peptide

LPLTVLGPESFK

Modified Peptide

n[43]LPLTVLGPESFK

Peptide Length

12

ORF Length

59

Open Reading Frame (ORF)

LPLTVLGPESFKSTFGCVSPQTHARRAEQVEKTNRGFGQEPRSVGTAEEQGGPGRRLRG

Conservation Score

0.018

PhyloCSF Frame 1

-5.567

No. of Spectra

2

CPC Coding Probability

0.0258737

PhyloCSF Frame 2 

-2.561

CNTI Index

noncoding

Max Probability

0.6483

PhyloCSF Frame 3

-3.6

CNTI Score

-0.303200278