McDonnell Genome Institute

Washington University

Transcript

lnc-PTPN12-2:1

Chromosome

chr7

Gene Name

lnc-PTPN12-2

Start

77461457

CPC Label

coding

End

77462139

Cancer

EOGC

Strand

+

Peptide

SVCLFGAGTLNWTLCK

Modified Peptide

n[145]SVCLFGAGTLNWTLCK

Peptide Length

16

ORF Length

80

Open Reading Frame (ORF)

MTLLTCMQLLGLSGGSTLKHSLPTCSRAHVRSVCLFGAGTLNWTLCKHHLFANKPDTGGDLFAIQCLDEHLRHTLETLKH

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.518068

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.748

PhyloCSF Frame 3

0

CNTI Score

-0.343775726