McDonnell Genome Institute

Washington University

Transcript

lnc-PTPA-4:1

Chromosome

chr9

Gene Name

lnc-PTPA-4

Start

129321015

CPC Label

coding

End

129324905

Cancer

BRCA-Luminal B

Strand

+

Peptide

AGLSLDSDAHPEPHPR

Modified Peptide

n[145]AGLSLDSDAHPEPHPR

Peptide Length

16

ORF Length

67

Open Reading Frame (ORF)

LSAHPGVRAGLSLDSDAHPEPHPRKGLFHPCIISLELMAESAHLQIRCLPVRSELGEGSNLVSPVHC

Conservation Score

0.094

PhyloCSF Frame 1

0

No. of Spectra

6

CPC Coding Probability

0.897453

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9971

PhyloCSF Frame 3

0

CNTI Score

-0.322637693