McDonnell Genome Institute

Washington University

Transcript

lnc-PTPA-3:4

Chromosome

chr9

Gene Name

lnc-PTPA-3

Start

129282509

CPC Label

noncoding

End

129287429

Cancer

EOGC

Strand

+

Peptide

EAAGDLK

Modified Peptide

n[145]EAAGDLK

Peptide Length

7

ORF Length

33

Open Reading Frame (ORF)

LIPPAWLEACRPGRQAREAAGDLKMHSLPQAQE

Conservation Score

0.094

PhyloCSF Frame 1

-3.323

No. of Spectra

24

CPC Coding Probability

0.143941

PhyloCSF Frame 2 

-4.49

CNTI Index

noncoding

Max Probability

0.9999

PhyloCSF Frame 3

-4.632

CNTI Score

-0.344149056