McDonnell Genome Institute

Washington University

Transcript

lnc-PTP4A3-8:1

Chromosome

chr8

Gene Name

lnc-PTP4A3-8

Start

141576436

CPC Label

noncoding

End

141578968

Cancer

BRCA-Basal-like

Strand

+

Peptide

LVESLTIAGK

Modified Peptide

n[145]LVESLTIAGK

Peptide Length

10

ORF Length

40

Open Reading Frame (ORF)

LVESLTIAGKGNNELELTVWNGREEMGREEMGREVLAAHF

Conservation Score

0.958

PhyloCSF Frame 1

0

No. of Spectra

3

CPC Coding Probability

0.211592

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9985

PhyloCSF Frame 3

0

CNTI Score

-0.295588969