McDonnell Genome Institute

Washington University

Transcript

lnc-PTP4A3-7:3

Chromosome

chr8

Gene Name

lnc-PTP4A3-7

Start

141507981

CPC Label

noncoding

End

141509737

Cancer

OSCC

Strand

+

Peptide

LVAQQSVVEMSLK

Modified Peptide

n[145]LVAQQSVVEM[147]SLK

Peptide Length

13

ORF Length

41

Open Reading Frame (ORF)

LVAQQSVVEMSLKLRSPDPSLGRQWPCLTSGHPHRRRKHKT

Conservation Score

0.081

PhyloCSF Frame 1

-1.346

No. of Spectra

3

CPC Coding Probability

0.0319332

PhyloCSF Frame 2 

-5.073

CNTI Index

noncoding

Max Probability

0.7786

PhyloCSF Frame 3

-3.42

CNTI Score

-0.373755322