McDonnell Genome Institute

Washington University

Transcript

lnc-PTP4A3-3:1

Chromosome

chr8

Gene Name

lnc-PTP4A3-3

Start

141325032

CPC Label

noncoding

End

141327129

Cancer

HCC

Strand

+

Peptide

AAATEGGGGGGGGK

Modified Peptide

n[230]AAATEGGGGGGGGK

Peptide Length

14

ORF Length

57

Open Reading Frame (ORF)

LPAPSRAAATEGGGGGGGGKDPERAWGQRSSILWPLRTHCSFSQMPPGLAQLPCPPI

Conservation Score

0.018

PhyloCSF Frame 1

-3.106

No. of Spectra

2

CPC Coding Probability

0.127318

PhyloCSF Frame 2 

-3.195

CNTI Index

noncoding

Max Probability

0.8296

PhyloCSF Frame 3

-3.329

CNTI Score

-0.274651628