McDonnell Genome Institute

Washington University

Transcript

lnc-PTP4A3-1:1

Chromosome

chr8

Gene Name

lnc-PTP4A3-1

Start

141374179

CPC Label

noncoding

End

141382226

Cancer

PRAD

Strand

+

Peptide

HFHHPKWETPFLPPSPGNQQSVLISMMCPLWAFCINGIM

Modified Peptide

HFHHPKWETPFLPPSPGNQQSVLISM[147]MCPLWAFCINGIM

Peptide Length

39

ORF Length

108

Open Reading Frame (ORF)

LRNHPATERWSQDLNHSGPWQRRLPGGRPPPCGVSSRQQRPGGFHPSPLYILAVFDIFTGGAPSPLLPKHFHHPKWETPFLPPSPGNQQSVLISMMCPLWAFCINGIM

Conservation Score

0.134

PhyloCSF Frame 1

-4.024

No. of Spectra

1

CPC Coding Probability

0.0423462

PhyloCSF Frame 2 

-4.764

CNTI Index

noncoding

Max Probability

0.0581

PhyloCSF Frame 3

-2.697

CNTI Score

-0.35663023