McDonnell Genome Institute

Washington University

Transcript

lnc-PTP4A2-6:1

Chromosome

chr1

Gene Name

lnc-PTP4A2-6

Start

32009478

CPC Label

noncoding

End

32013528

Cancer

LUAD

Strand

-

Peptide

ASSTTPDLLK

Modified Peptide

n[230]ASSTTPDLLK

Peptide Length

10

ORF Length

49

Open Reading Frame (ORF)

MASSTTPDLLKETLATTLKGKVHSGQSPTTFSTSWCAICKWSLRSLLVP

Conservation Score

0.098

PhyloCSF Frame 1

-4.194

No. of Spectra

32

CPC Coding Probability

0.08556

PhyloCSF Frame 2 

-3.155

CNTI Index

noncoding

Max Probability

0.7157

PhyloCSF Frame 3

-5.263

CNTI Score

-0.362918401