McDonnell Genome Institute

Washington University

Transcript

lnc-PTP4A1-7:1

Chromosome

chr6

Gene Name

lnc-PTP4A1-7

Start

63440765

CPC Label

coding

End

63443580

Cancer

LUAD

Strand

+

Peptide

MTNADSEGGNLR

Modified Peptide

n[272]M[147]TNADSEGGNLR

Peptide Length

12

ORF Length

74

Open Reading Frame (ORF)

MTNADSEGGNLRHQLDSNKQDLSLSNLDEDPVKELAALPKTTTLDLVKLHLKKINNDYSPVGFLWPHTPGEARP

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.538676

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.7508

PhyloCSF Frame 3

0

CNTI Score

-0.316352265