McDonnell Genome Institute

Washington University

Transcript

lnc-PTP4A1-5:1

Chromosome

chr6

Gene Name

lnc-PTP4A1-5

Start

63475872

CPC Label

noncoding

End

63477129

Cancer

OV

Strand

+

Peptide

LQLDIGWNCDHLK

Modified Peptide

n[145]LQLDIGWNCDHLK

Peptide Length

13

ORF Length

70

Open Reading Frame (ORF)

LQLDIGWNCDHLKAQLDWMSKIQGSRCWLSAGSSTGAINSSTYMLFLHVAGSSHSAAARLQNIVSQEGRV

Conservation Score

0.124

PhyloCSF Frame 1

-4.949

No. of Spectra

3

CPC Coding Probability

0.0646432

PhyloCSF Frame 2 

-2.696

CNTI Index

noncoding

Max Probability

0.8257

PhyloCSF Frame 3

-4.061

CNTI Score

-0.367680433