McDonnell Genome Institute

Washington University

Transcript

lnc-PTN-9:1

Chromosome

chr7

Gene Name

lnc-PTN-9

Start

136938279

CPC Label

noncoding

End

136938553

Cancer

BRCA-Luminal B

Strand

-

Peptide

SINQSLLSPLILEVNPNIQAVR

Modified Peptide

n[145]SINQSLLSPLILEVNPNIQAVR

Peptide Length

22

ORF Length

88

Open Reading Frame (ORF)

LQSRSINQSLLSPLILEVNPNIQAVRIQGKEQIKTLNKKFASFIDKVRFLEQQNKMLETKWSLLQQQTTTRSNMDNMFESYINNLRRQ

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

7

CPC Coding Probability

0.0358603

PhyloCSF Frame 2 

0

CNTI Index

coding

Max Probability

0.4274

PhyloCSF Frame 3

0

CNTI Score

0.725214323