McDonnell Genome Institute

Washington University

Transcript

lnc-PTN-2:4

Chromosome

chr7

Gene Name

lnc-PTN-2

Start

136785831

CPC Label

coding

End

137182107

Cancer

OV

Strand

-

Peptide

SSHLILQELGLKTVDH

Modified Peptide

n[145]SSHLILQELGLKTVDH

Peptide Length

16

ORF Length

65

Open Reading Frame (ORF)

LLTLGAVDQSCSYSAILAPPPGVGVPLLPRLECSGKTGSLQPPPPGIKRSSHLILQELGLKTVDH

Conservation Score

0.384

PhyloCSF Frame 1

0

No. of Spectra

2

CPC Coding Probability

0.820194

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9634

PhyloCSF Frame 3

0

CNTI Score

-0.332180942