McDonnell Genome Institute

Washington University

Transcript

lnc-PTN-2:12

Chromosome

chr7

Gene Name

lnc-PTN-2

Start

136743762

CPC Label

noncoding

End

137164275

Cancer

HCC

Strand

-

Peptide

LVLLSEEGR

Modified Peptide

n[230]LVLLSEEGR

Peptide Length

9

ORF Length

80

Open Reading Frame (ORF)

LWNAKDTWSARKLVLLSEEGRFGALEDSNCRCRGTGRESQLVMPKGQPNLCSFSNHGSFSTSVFNSSSRSCFSVRIKCEN

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

5

CPC Coding Probability

0.214788

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9655

PhyloCSF Frame 3

0

CNTI Score

-0.352275168