McDonnell Genome Institute

Washington University

Transcript

lnc-PTK2B-1:1

Chromosome

chr8

Gene Name

lnc-PTK2B-1

Start

27501449

CPC Label

noncoding

End

27501694

Cancer

OV

Strand

+

Peptide

VTQTGLELLGSNDTPTLVFQSAR

Modified Peptide

n[145]VTQTGLELLGSNDTPTLVFQSAR

Peptide Length

23

ORF Length

81

Open Reading Frame (ORF)

LECSGMIMAHCSLYLLGSDDPPTSASQVAGITGTHHHAQLFFVLLLLLLEMGFHRVTQTGLELLGSNDTPTLVFQSARITG

Conservation Score

0.173

PhyloCSF Frame 1

0

No. of Spectra

2

CPC Coding Probability

0.033768

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.4667

PhyloCSF Frame 3

0

CNTI Score

-0.47968686