McDonnell Genome Institute

Washington University

Transcript

lnc-PTK2-3:1

Chromosome

chr8

Gene Name

lnc-PTK2-3

Start

140598138

CPC Label

noncoding

End

140598678

Cancer

OV

Strand

-

Peptide

ILFGAVALEHLDK

Modified Peptide

n[145]ILFGAVALEHLDK

Peptide Length

13

ORF Length

59

Open Reading Frame (ORF)

LLPLPKRILFGAVALEHLDKALEVVLQHRTRRLGVQTSSHTGRGRSCGCLFPDPEVGSG

Conservation Score

0.224

PhyloCSF Frame 1

-4.843

No. of Spectra

1

CPC Coding Probability

0.0376492

PhyloCSF Frame 2 

-5.167

CNTI Index

noncoding

Max Probability

0.4048

PhyloCSF Frame 3

-4.725

CNTI Score

-0.337930439