McDonnell Genome Institute

Washington University

Transcript

lnc-PTH2R-1:4

Chromosome

chr2

Gene Name

lnc-PTH2R-1

Start

208642241

CPC Label

noncoding

End

208858678

Cancer

PRAD

Strand

+

Peptide

LGEFSWMISLNMFYK

Modified Peptide

LGEFSWM[147]ISLNMFYK

Peptide Length

15

ORF Length

41

Open Reading Frame (ORF)

MLASRLGEFSWMISLNMFYKLLTFSPSLSRIQMRHRFVLFT

Conservation Score

0.228

PhyloCSF Frame 1

0

No. of Spectra

13

CPC Coding Probability

0.0694062

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9961

PhyloCSF Frame 3

0

CNTI Score

-0.322916104