McDonnell Genome Institute

Washington University

Transcript

lnc-PTH-4:1

Chromosome

chr11

Gene Name

lnc-PTH-4

Start

13610362

CPC Label

noncoding

End

13610771

Cancer

EOGC

Strand

-

Peptide

ADAGKEGNNPAENGETKTDHAQK

Modified Peptide

n[145]ADAGKEGNNPAENGETKTDHAQK

Peptide Length

23

ORF Length

109

Open Reading Frame (ORF)

LRPLHPMPSTYHPPQSPTPCPRRKAKGDAKGVKAKVKDKPQRRSVRLTAKPAPPKPGSKPKKGPAKNGEKVLKGKKGKADAGKEGNNPAENGETKTDHAQKAEGAGDAK

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

2

CPC Coding Probability

0.37081

PhyloCSF Frame 2 

0

CNTI Index

coding

Max Probability

0.2326

PhyloCSF Frame 3

0

CNTI Score

0.640164804