McDonnell Genome Institute

Washington University

Transcript

lnc-PTGS1-1:3

Chromosome

chr9

Gene Name

lnc-PTGS1-1

Start

122324607

CPC Label

noncoding

End

122325315

Cancer

OV

Strand

+

Peptide

TGALQQSFMSGR

Modified Peptide

n[145]TGALQQSFMSGR

Peptide Length

12

ORF Length

34

Open Reading Frame (ORF)

MTGALQQSFMSGRNPPLTANVLLKDAGFFNKQRK

Conservation Score

1

PhyloCSF Frame 1

-2.183

No. of Spectra

13

CPC Coding Probability

0.018223

PhyloCSF Frame 2 

-3.179

CNTI Index

noncoding

Max Probability

0.998

PhyloCSF Frame 3

-5.117

CNTI Score

-0.406775106