McDonnell Genome Institute

Washington University

Transcript

lnc-PTGIR-3:1

Chromosome

chr19

Gene Name

lnc-PTGIR-3

Start

46611193

CPC Label

noncoding

End

46614409

Cancer

HCC

Strand

-

Peptide

LAACETK

Modified Peptide

n[230]LAACETK

Peptide Length

7

ORF Length

54

Open Reading Frame (ORF)

LAACETKAVNATPLPKASRGSPTAGPAPAFLSSPGWAPSCSGLSPSLAGFPSVP

Conservation Score

0.025

PhyloCSF Frame 1

-5.319

No. of Spectra

46

CPC Coding Probability

0.060267

PhyloCSF Frame 2 

-4.569

CNTI Index

noncoding

Max Probability

0.9999

PhyloCSF Frame 3

-4.903

CNTI Score

-0.375248303