McDonnell Genome Institute

Washington University

Transcript

lnc-PTDSS1-2:1

Chromosome

chr8

Gene Name

lnc-PTDSS1-2

Start

95969432

CPC Label

coding

End

95984638

Cancer

OV

Strand

+

Peptide

LDLDIMVDWK

Modified Peptide

n[145]LDLDIMVDWK

Peptide Length

10

ORF Length

152

Open Reading Frame (ORF)

LDLDIMVDWKISLKAEQHAQCKALTPSSRTNERVKLDQDPSWPQTQACKMLLAFTHSRGICWWDLRDRLQFSEGLPQNWRMRNSMCAHICILHLHLPHELNPERNICLAGSADGQISLSQQTEPLQGVGPQVQMASRGASHLGGKLLASWSS

Conservation Score

1

PhyloCSF Frame 1

-4.264

No. of Spectra

2

CPC Coding Probability

0.886539

PhyloCSF Frame 2 

-4.494

CNTI Index

noncoding

Max Probability

0.3497

PhyloCSF Frame 3

-4.591

CNTI Score

-0.387066715