McDonnell Genome Institute

Washington University

Transcript

lnc-PTCH1-2:1

Chromosome

chr9

Gene Name

lnc-PTCH1-2

Start

95599544

CPC Label

noncoding

End

95606286

Cancer

PRAD

Strand

-

Peptide

SPGHLGHSK

Modified Peptide

‚Äč

Peptide Length

9

ORF Length

44

Open Reading Frame (ORF)

MASSERGVIGCCHTGVWTAITRSPGHLGHSKVSAFEVLQEEFCC

Conservation Score

0.037

PhyloCSF Frame 1

-5.889

No. of Spectra

1

CPC Coding Probability

0.0212259

PhyloCSF Frame 2 

-0.123

CNTI Index

noncoding

Max Probability

0.9988

PhyloCSF Frame 3

-5.773

CNTI Score

-0.419344669