McDonnell Genome Institute

Washington University

Transcript

lnc-PTBP3-8:2

Chromosome

chr9

Gene Name

lnc-PTBP3-8

Start

112469722

CPC Label

noncoding

End

112486676

Cancer

BRCA-Basal-like

Strand

-

Peptide

EVGAIHPPRAR

Modified Peptide

n[145]EVGAIHPPRAR

Peptide Length

11

ORF Length

92

Open Reading Frame (ORF)

LPHTRSHAAAGALDREVGAIHPPRARAQSLLPRQVWNPPSPLWSEEVYSTAPYYTSWARGPRCPPELCAPPLKRKEQTEPTPSVSVSTGSIT

Conservation Score

0.323

PhyloCSF Frame 1

-1.147

No. of Spectra

1

CPC Coding Probability

0.120724

PhyloCSF Frame 2 

-3.036

CNTI Index

noncoding

Max Probability

0.1483

PhyloCSF Frame 3

-3.858

CNTI Score

-0.31622169