McDonnell Genome Institute

Washington University

Transcript

lnc-PTBP2-12:2

Chromosome

chr1

Gene Name

lnc-PTBP2-12

Start

96060935

CPC Label

noncoding

End

96090631

Cancer

CCRC

Strand

+

Peptide

TGIGGPK

Modified Peptide

n[230]TGIGGPK

Peptide Length

7

ORF Length

58

Open Reading Frame (ORF)

LMERTSRTGIGGPKSSCTDSIQLCSVHPHPKPVPIPRQIEAVDKDCFCPPHLQYSVFK

Conservation Score

0.665

PhyloCSF Frame 1

-6.2

No. of Spectra

3

CPC Coding Probability

0.167604

PhyloCSF Frame 2 

-5.079

CNTI Index

noncoding

Max Probability

0.9986

PhyloCSF Frame 3

-5.8

CNTI Score

-0.354652172