McDonnell Genome Institute

Washington University

Transcript

lnc-PTAFR-9:1

Chromosome

chr1

Gene Name

lnc-PTAFR-9

Start

28120448

CPC Label

noncoding

End

28121321

Cancer

PRAD

Strand

-

Peptide

DNIDITLQWLIQHSKSGR

Modified Peptide

Peptide Length

18

ORF Length

49

Open Reading Frame (ORF)

LDEKQLIEKMSLCAIEDREVCRYSISCKEKDNIDITLQWLIQHSKSGRS

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.0852733

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.5391

PhyloCSF Frame 3

0

CNTI Score

-0.310095008