McDonnell Genome Institute

Washington University

Transcript

lnc-PSMG4-18:4

Chromosome

chr6

Gene Name

lnc-PSMG4-18

Start

3464385

CPC Label

noncoding

End

3478652

Cancer

PRAD

Strand

+

Peptide

VAGITGMCHHAWQPPK

Modified Peptide

VAGITGM[147]CHHAWQPPK

Peptide Length

16

ORF Length

47

Open Reading Frame (ORF)

LEPPGSAHCNLRLPDSRDSSASASRVAGITGMCHHAWQPPKVLELQA

Conservation Score

0.612

PhyloCSF Frame 1

0

No. of Spectra

7

CPC Coding Probability

0.0856535

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.6986

PhyloCSF Frame 3

0

CNTI Score

-0.423733764