McDonnell Genome Institute

Washington University

Transcript

lnc-PSMG4-11:1

Chromosome

chr6

Gene Name

lnc-PSMG4-11

Start

3382554

CPC Label

noncoding

End

3396848

Cancer

OV

Strand

+

Peptide

INMEVDNDTK

Modified Peptide

n[145]INM[147]EVDNDTK

Peptide Length

10

ORF Length

49

Open Reading Frame (ORF)

LSVGKSLKKHIFLVARINMEVDNDTKKINHGTELPFGFSWEHHREASVP

Conservation Score

0.964

PhyloCSF Frame 1

-4.768

No. of Spectra

3

CPC Coding Probability

0.0410057

PhyloCSF Frame 2 

-4.799

CNTI Index

noncoding

Max Probability

0.9238

PhyloCSF Frame 3

-5.061

CNTI Score

-0.286281997