McDonnell Genome Institute

Washington University

Transcript

lnc-PSMG1-4:7

Chromosome

chr21

Gene Name

lnc-PSMG1-4

Start

38992744

CPC Label

noncoding

End

39082787

Cancer

BRCA-HER2-enriched

Strand

-

Peptide

TAPHIQK

Modified Peptide

n[145]TAPHIQK

Peptide Length

7

ORF Length

108

Open Reading Frame (ORF)

LLHVLLLAVPSASFLSFSVSRGCSLPVSLLRVGCLILPAAGPVTRTAPHIQKVLGHGGHLFNERKFSKSLLSNVLLWFLLLCSPLNSKASSQLHLGIFSTPCMDPESG

Conservation Score

0.216

PhyloCSF Frame 1

-4.13

No. of Spectra

5

CPC Coding Probability

0.325281

PhyloCSF Frame 2 

-3.201

CNTI Index

noncoding

Max Probability

0.9964

PhyloCSF Frame 3

-3.246

CNTI Score

-0.321779407