McDonnell Genome Institute

Washington University

Transcript

lnc-PSMD7-4:2

Chromosome

chr16

Gene Name

lnc-PSMD7-4

Start

74265494

CPC Label

noncoding

End

74269056

Cancer

OSCC

Strand

+

Peptide

AYILGEK

Modified Peptide

n[145]AYILGEK

Peptide Length

7

ORF Length

37

Open Reading Frame (ORF)

LVFKLPNMKAYILGEKKLTPKLLHKIKYFIFQSFRII

Conservation Score

1

PhyloCSF Frame 1

-3.342

No. of Spectra

25

CPC Coding Probability

0.134453

PhyloCSF Frame 2 

-4.736

CNTI Index

noncoding

Max Probability

0.995

PhyloCSF Frame 3

0.637

CNTI Score

-0.365463853