McDonnell Genome Institute

Washington University

Transcript

lnc-PSMD7-3:1

Chromosome

chr16

Gene Name

lnc-PSMD7-3

Start

74282414

CPC Label

noncoding

End

74287519

Cancer

OV

Strand

+

Peptide

MESLSVTQDSVSK

Modified Peptide

n[145]MESLSVTQDSVSK

Peptide Length

13

ORF Length

64

Open Reading Frame (ORF)

MESLSVTQDSVSKKKKESAEFGITVPTDIGHKLNSVNLTFKWAGNEYAPLFLSTANLPSQATTC

Conservation Score

0.167

PhyloCSF Frame 1

0

No. of Spectra

3

CPC Coding Probability

0.0698338

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9239

PhyloCSF Frame 3

0

CNTI Score

-0.457200716