McDonnell Genome Institute

Washington University

Transcript

lnc-PSMC5-1:1

Chromosome

chr17

Gene Name

lnc-PSMC5-1

Start

63900555

CPC Label

noncoding

End

63901894

Cancer

EOGC

Strand

+

Peptide

EEESQFAVQEEK

Modified Peptide

n[145]EEESQFAVQEEK

Peptide Length

12

ORF Length

87

Open Reading Frame (ORF)

LGSVSKDIAVIVQGLDEGISSTLFVIITVALGVGVITIALYLSYRPCKVDRKKLLYRQKEEDKEEESQFAVQEEKSATHIIDSYLIE

Conservation Score

1

PhyloCSF Frame 1

6.813

No. of Spectra

9

CPC Coding Probability

0.351753

PhyloCSF Frame 2 

2.329

CNTI Index

coding

Max Probability

0.9993

PhyloCSF Frame 3

-3.897

CNTI Score

0.669364417