McDonnell Genome Institute

Washington University

Transcript

lnc-PSMC3IP-3:8

Chromosome

chr17

Gene Name

lnc-PSMC3IP-3

Start

42544554

CPC Label

coding

End

42562027

Cancer

HCC

Strand

-

Peptide

FIASGGR

Modified Peptide

n[230]FIASGGR

Peptide Length

7

ORF Length

127

Open Reading Frame (ORF)

LESRTTPGFLKPVLGKMELSYSKVEKTGGGAGRRTGNVELGFRHIKFIASGGRVVLSRQLEIQTWSLWETVGFLWWGGHRHLSAIRSHGTAEDYINNVNIHKLEKMNVRKRGGHTLPLIIPPPGVTL

Conservation Score

0.295

PhyloCSF Frame 1

0

No. of Spectra

15

CPC Coding Probability

0.583379

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9987

PhyloCSF Frame 3

0

CNTI Score

-0.242197783