McDonnell Genome Institute

Washington University

Transcript

lnc-PSMC2-1:1

Chromosome

chr7

Gene Name

lnc-PSMC2-1

Start

103445206

CPC Label

noncoding

End

103514007

Cancer

OV

Strand

+

Peptide

GWISTEGIR

Modified Peptide

n[145]GWISTEGIR

Peptide Length

9

ORF Length

88

Open Reading Frame (ORF)

LGAPGGQCRASPARHRRRQGPSPERGPEAELRAWFCVIRFGYKQARPKLETAKGWISTEGIRGGKREVKMLCGAAEGKGTGVAKERAS

Conservation Score

0.035

PhyloCSF Frame 1

-1.635

No. of Spectra

1

CPC Coding Probability

0.0647716

PhyloCSF Frame 2 

-2.28

CNTI Index

noncoding

Max Probability

0.8655

PhyloCSF Frame 3

-2.758

CNTI Score

-0.259324658