McDonnell Genome Institute

Washington University

Transcript

lnc-PSMB9-6:14

Chromosome

chr6

Gene Name

lnc-PSMB9-6

Start

32894759

CPC Label

noncoding

End

32910526

Cancer

LUAD

Strand

+

Peptide

LTTFENSR

Modified Peptide

n[230]LTTFENSR

Peptide Length

8

ORF Length

51

Open Reading Frame (ORF)

LKTTYLYRKLTTFENSRKYNTQAHNLLGIREIVITIHHMPLLSLANPSVHL

Conservation Score

0.781

PhyloCSF Frame 1

0

No. of Spectra

4

CPC Coding Probability

0.0910912

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9988

PhyloCSF Frame 3

0

CNTI Score

-0.391796298