McDonnell Genome Institute

Washington University

Transcript

lnc-PSMB9-14:1

Chromosome

chr6

Gene Name

lnc-PSMB9-14

Start

32825982

CPC Label

noncoding

End

32826805

Cancer

PRAD

Strand

+

Peptide

NFQDILR

Modified Peptide

Peptide Length

7

ORF Length

35

Open Reading Frame (ORF)

LGVSPEIRNFQDILRSTASSCTAHQDKFSTQLYHD

Conservation Score

0.319

PhyloCSF Frame 1

-4.087

No. of Spectra

19

CPC Coding Probability

0.0134919

PhyloCSF Frame 2 

-4.532

CNTI Index

noncoding

Max Probability

0.9997

PhyloCSF Frame 3

-4.079

CNTI Score

-0.517231329