McDonnell Genome Institute

Washington University

Transcript

lnc-PSMB3-2:1

Chromosome

chr17

Gene Name

lnc-PSMB3-2

Start

38749359

CPC Label

coding

End

38751457

Cancer

HCC

Strand

+

Peptide

DGGGEEEEGR

Modified Peptide

n[230]DGGGEEEEGR

Peptide Length

10

ORF Length

96

Open Reading Frame (ORF)

LERLPPLPSLLAAKAAAKLGASGECFRPLAGDQETCAHWPPSDPSSSLQPHQRDGGGEEEEGRRDFLPEGVVREPAGEGPREDPVTCSGACRRRGE

Conservation Score

0.893

PhyloCSF Frame 1

-3.14

No. of Spectra

25

CPC Coding Probability

0.5

PhyloCSF Frame 2 

-2.887

CNTI Index

noncoding

Max Probability

0.9976

PhyloCSF Frame 3

-3.699

CNTI Score

-0.305509772