McDonnell Genome Institute

Washington University

Transcript

lnc-PSMB1-6:1

Chromosome

chr6

Gene Name

lnc-PSMB1-6

Start

170296228

CPC Label

noncoding

End

170306561

Cancer

OSCC

Strand

-

Peptide

SDVIASEK

Modified Peptide

n[145]SDVIASEK

Peptide Length

8

ORF Length

63

Open Reading Frame (ORF)

LNNFTRFSGGGAGWAGGKALGADLRIRSDVIASEKLNSPVLWGVQINIFSDSVHTKAAHCGHV

Conservation Score

1

PhyloCSF Frame 1

-1.704

No. of Spectra

7

CPC Coding Probability

0.36717

PhyloCSF Frame 2 

0

CNTI Index

coding

Max Probability

0.9932

PhyloCSF Frame 3

4.301

CNTI Score

0.736583945