McDonnell Genome Institute

Washington University

Transcript

lnc-PSMB1-11:1

Chromosome

chr6

Gene Name

lnc-PSMB1-11

Start

170294177

CPC Label

noncoding

End

170295905

Cancer

CCRC

Strand

-

Peptide

GRVAPGPGRTGEVTR

Modified Peptide

n[230]GRVAPGPGRTGEVTR

Peptide Length

15

ORF Length

91

Open Reading Frame (ORF)

MPPLLAAGLASAPGSTHARGGRLAGPWRGSDSPHRKTTPRHEPGGVGARLPVLCTAADPEKGKGRVAPGPGRTGEVTRRVSSGAAAASGEA

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.0857276

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.0761

PhyloCSF Frame 3

0

CNTI Score

-0.293836974