McDonnell Genome Institute

Washington University

Transcript

lnc-PSMA6-3:1

Chromosome

chr14

Gene Name

lnc-PSMA6-3

Start

35262461

CPC Label

noncoding

End

35263036

Cancer

BRCA-Luminal B

Strand

+

Peptide

MRTGVACSVSQAQK

Modified Peptide

n[145]M[147]RTGVACSVSQAQK

Peptide Length

14

ORF Length

75

Open Reading Frame (ORF)

LGEKYILRVRMRTGVACSVSQAQKDELILEGNDIELVSNLEALIQQATTVKNKDIRKFLDGIYVSEKGTVQPADE

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

6

CPC Coding Probability

0.197028

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.7148

PhyloCSF Frame 3

0

CNTI Score

-0.361929571