McDonnell Genome Institute

Washington University

Transcript

lnc-PSG9-4:1

Chromosome

chr19

Gene Name

lnc-PSG9-4

Start

43368393

CPC Label

noncoding

End

43369075

Cancer

OV

Strand

-

Peptide

AISFGLFTPLASVNNAAMNK

Modified Peptide

n[145]AISFGLFTPLASVNNAAM[147]NK

Peptide Length

20

ORF Length

90

Open Reading Frame (ORF)

LNVRFVFGQRKAISFGLFTPLASVNNAAMNKDMQIPAGAPALSSFQNTPEVELLHRVCILEVFPSGSTEGYFNKNGQHRWTAIRAMKSLA

Conservation Score

0.338

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.0673648

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.6396

PhyloCSF Frame 3

0

CNTI Score

-0.38093603