McDonnell Genome Institute

Washington University

Transcript

lnc-PSD3-7:2

Chromosome

chr8

Gene Name

lnc-PSD3-7

Start

19139162

CPC Label

noncoding

End

19141530

Cancer

OV

Strand

-

Peptide

MTLIHEDSPFMTSSSLIQPHFPTLWHWGLR

Modified Peptide

n[145]MTLIHEDSPFMTSSSLIQPHFPTLWHWGLR

Peptide Length

30

ORF Length

40

Open Reading Frame (ORF)

MTLIHEDSPFMTSSSLIQPHFPTLWHWGLRLQHMNFREYL

Conservation Score

0.047

PhyloCSF Frame 1

-4.004

No. of Spectra

5

CPC Coding Probability

0.0413892

PhyloCSF Frame 2 

-4.744

CNTI Index

noncoding

Max Probability

0.7776

PhyloCSF Frame 3

-4.668

CNTI Score

-0.370591031